Search

Mailing Lists

West Nile Virus Pre-M Recombinant Protein

Catalog Number:
WNV-002-005P
Price: $215.00
Detailed Description

WNV-002-005P

Name

West Nile Virus Pre-M Recombinant Protein

Description

The E. coli derived 20 kDa recombinant protein contains the West-Nile virus N-terminal Pre-M immunodominant region

(MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTIT

YECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTH

GESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE).

The protein is fused with 6x His tag at C-terminal.

Source

E.coli

Application

Western Blot, ELISA, etc.

Purity

> 95% (by SDS-PAGE)

Size

50 µg


Click here for DATA SHEET